LL-37 For Sale
LL-37 | 5mg | Human Cathelicidin Antimicrobial Peptide
For In Vitro Research Use Only — Not for Human or Veterinary Use
Description:
LL-37 is a cationic amphipathic peptide derived from the human cathelicidin antimicrobial protein hCAP-18. It is widely studied in vitro for its role in innate immune defense, antimicrobial activity, wound repair, and inflammatory signaling pathways.
As the only human cathelicidin identified to date, LL-37 is of significant interest in laboratory models examining host defense peptides, bacterial resistance, and immunomodulation. This vial contains 5mg of lyophilized LL-37 peptide, optimized for controlled laboratory experimentation.
Specifications:
-
Unit Size: 5mg (lyophilized powder, single vial)
-
Sequence: [LL-37, 37 aa]
-
Molecular Formula: C₂₀₃H₃₁₈N₆₀O₄₉
-
Molecular Weight: ~4493.3 Da
-
Form: Crystalline lyophilized peptide
-
Solubility: Soluble in sterile water, PBS, or compatible buffers
-
Storage: Store dry at 2°C–8°C.
Application Context:
LL-37 is studied in vitro for potential roles in:
-
Antimicrobial activity against bacteria, viruses, and fungi
-
Innate immune response and host defense mechanisms
-
Wound healing and epithelial repair
-
Cell signaling and inflammatory pathway modulation
Intended Use:
This compound is intended strictly for in vitro laboratory research use. It is not approved for human or animal use and must not be incorporated into food, drugs, cosmetics, or supplements.
Legal Disclaimer:
This product and its associated information have not been evaluated by the U.S. Food and Drug Administration. No claims are made regarding diagnosis, treatment, cure, or prevention of disease. Research use is restricted to qualified professionals in certified laboratory environments.
Terms of Sale:
By purchasing from Mile High Compounds, the buyer affirms they are a qualified researcher or institution, fully responsible for the lawful handling, storage, and research use of this material. All sales are final.














Reviews
There are no reviews yet.